Y04801 Recombinant Human Vitronectin

Y04801

≤1 EU/mg by the LAL method

Measured by the ability of the immobilized protein to support the adhesion of NIH3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 2-10 μg/mL. Optimal concentration depends on cell type as well as the application or research objectives.

Vitronectin; VN; S-Protein; Serum-Spreading Factor; V75; VTN

DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Asp20-Leu478

Tag free

Lyophilized

PBS,5% mannitol and 0.01% Tween 80, pH7.4

10μg/vail 50μg/vail 1mg/vail

Products are in stock,but custom products may require further consultation

It is recommended to redissolve in sterile deionized water.

The product is shipped with blue ice

36 months at 2°C to 8°C in lyophilized state

6 months at -20°C to -80°C under sterile conditions after reconstitution

7-10 days at 2°C to 8°C under sterile conditions after reconstitution

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.