Y04201N Recombinant Human TGF-β1

Y04201N

≤10 EU/mg by the LAL method

Measured in a cell inhibition assay using TF-1 cells at IL4 presence. The ED₅₀ for this effect is ≤0.1ng/mL.

Transforming Growth Factor Beta-1; TGF-Beta-1; Latency-Associated Peptide; LAP; TGFB1; TGFB

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Ala279-Ser390

Tag free

Lyophilized

0.085% TFA, 30% ACN, 5% mannitol, pH 2.5

10μg/vail 50μg/vail 1mg/vail

Products are in stock, but custom products may require further consultation.

It is recommended to redissolve in 4mM HCL.

The product is shipped with blue ice.

36 months at 2°C to 8°C in lyophilized state

6 months at -20°C to -80°C under sterile conditions after reconstitution

7-10 days at 2°C to 8°C under sterile conditions after reconstitution

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.