Y04001 Recombinant Human IL-12

Y00401

Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED₅₀ for this effect is ＜0.5 ng/mL.

Interleukin-12 subunit alpha; IL-12A; Cytotoxic lymphocyte maturation factor 35 kDa subunit; CLMF p35; IL-12 subunit p35; NK cell; IL12A ; NKSF1 stimulatory factor chain 1 

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Ile23-Ser328&Arg23-Ser219 

Tag free

Lyophilized

PBS,5% mannitol and 0.01% Tween 80, pH7.4

10μg/vail 50μg/vail 1mg/vail

Products are in stock,but custom products may require further consultation  

It is recommended to redissolve in sterile deionized water.

The product is shipped with blue ice

36 months at 2°C to 8°C in lyophilized state

6 months at -20°C to -80°C under sterile conditions after reconstitution

7-10 days at 2°C to 8°C under sterile conditions after reconstitution

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.